Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

N/A

Uniprot No.

P02236

Research Area

Others

Species

Glycine max (Soybean) (Glycine hispida)

Source

E.coli

Expression Region

2-145aa

Target Protein Sequence

GAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

21.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Leghemoglobin C2 is a protein found in soybean nodules, and it is one of the three major forms of leghemoglobin present in these nodules, alongside leghemoglobin a and cl [1]. The amino acid differences between leghemoglobin a and leghemoglobin c2 of soybean indicate that they are likely encoded by independent genes, but they possess highly similar tertiary structures [2]. This suggests that despite being encoded by different genes, these proteins share structural similarities.

The safety of using recombinant soy leghemoglobin in food has been investigated, and it has been reported that there are no potential allergenicity and toxigenicity associated with its use [3]. This conclusion was drawn from a literature search, bioinformatics analyses on the amino acid sequence of leghemoglobin and 17 Pichia host proteins, as well as in vitro pepsin digestibility of leghemoglobin. This indicates that leghemoglobin C2, as a form of soy leghemoglobin, is considered safe for consumption.

Furthermore, leghemoglobin uses an iron cofactor, and it has been speculated that a decrease in nodule GmSACPD-C iron binding may lead to an increase in leghemoglobin iron binding and expression [4]. This suggests that the regulation of iron binding may impact the expression and function of leghemoglobin C2 in soybean nodules.

References:
[1] E. Truelsen, K. Gausing, B. Jochimsen, P. Jørgensen, & K. Marcker, "Cloning of soybean leghemoglobin structural gene sequences synthesized in vitro", Nucleic Acids Research, vol. 6, no. 9, p. 3061-3072, 1979. https://doi.org/10.1093/nar/6.9.3061
[2] W. Brill, "Biochemical genetics of nitrogen fixation.", Microbiological Reviews, vol. 44, no. 3, p. 449-467, 1980. https://doi.org/10.1128/mmbr.44.3.449-467.1980
[3] J. Hadi and G. Brightwell, "Safety of alternative proteins: technological, environmental and regulatory aspects of cultured meat, plant-based meat, insect protein and single-cell protein", Foods, vol. 10, no. 6, p. 1226, 2021. https://doi.org/10.3390/foods10061226
[4] N. Lakhssassi, V. Colantonio, N. Flowers, Z. Zhou, J. Henry, S. Liuet al., "Stearoyl-acyl carrier protein desaturase mutations uncover an impact of stearic acid in leaf and nodule structure", Plant Physiology, vol. 174, no. 3, p. 1531-1543, 2017. https://doi.org/10.1104/pp.16.01929

Target Background

Function

Provides oxygen to the bacteroids. This role is essential for symbiotic nitrogen fixation.

Protein Families

Plant globin family

Tissue Specificity

Root nodules.

Database Links

KEGG: gmx:100527379

STRING: 3847.GLYMA20G33290.1

UniGene: Gma.55908

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP365720GGV
MSDS	MSDS
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Glycine max Leghemoglobin C2

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage